Run LRRpredictor online


User guide

Protein name :

*between 3-20 alphanumerical characters and '_'. Other characters will throw an error.

Protein sequence :

*between 50-2000 amino acids (upper-case). Blank spaces and endline characters are also allowed.

Example:
MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIIEVAYTTEDMVDSES
RNVFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRE
NEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTS
DEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAEYASSGKPPHHMRL
MNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITLIAGLLSKISKTLDEWQNVAENVRSVVST
DLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERIYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVD
RSLISIHNVSFDGETQRCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIHNEEELV
WCRNSEAHSIITLCIFKCVTLELSFKLVRVLDLGLTTCPIFPSGVLSLIHLRYLSLRFNPRLQQYRGSKEAVP
SSIIDIPLSISSLCYLQTFKLYHPFPNCYPFILPSEILTMPQLRKLCMGWNYLRSHEPTENRLVLKSLQCLNE
LNPRYCTGSFLRLFPNLKKLEVFGVKEDFRNHKDLYDFRYLYQLEKLAFSTYYSSSACFLKNTAPLGSTPQDP
LRFQMETLHLETHSRATAPPTDVPTFLLPPPDCFPQNLKSLTFSGDFFLAWKDLSIVGKLPKLEVLQLSHNAF
KGEEWEVVEEGFPHLKFLFLDSIYIRYWRASSDHFPYLERLFLSDCFYLDSIPRDFADITTLALIDIFRCQQS
VGNSAKQIQQDIQDNYGSSIEVHTRYLYRNGAFLVV